Protein Info for Psest_4239 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 8 to 177 (170 residues), 74 bits, see alignment E=7e-25

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_0095)

Predicted SEED Role

"nickel-dependent hydrogenase b-type cytochrome subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTT5 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Psest_4239 Cytochrome b (Pseudomonas stutzeri RCH2)
MSGHIKLWDAPLRLFHWLFAGAVIAAIVSGWVGGSLMPWHGRLGLLVLGLLVFRLIWGFV
GSTYARWSRIFAATVGVKDYLQGNWREAGHNPLGAFSVLAMLLLVAFQVTSGLMATDDIA
FQGPLHALISSETGSALSGLHRQAKWLLLVLIGMHIAAIIYYTLVMRRPLVRAMIAGRTQ
REHPSQQNARGGSLPAAVLAIALGAACVWGVQAVGDWLRPEPAAVAPSLDW