Protein Info for PGA1_c04270 in Phaeobacter inhibens DSM 17395

Annotation: protein PhnJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06007: PhnJ
  • amino acids 3 to 273 (271 residues), 469.7 bits, E=1.2e-145

Best Hits

Swiss-Prot: 77% identical to PHNJ_RHIME: Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase (phnJ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06163, PhnJ protein (inferred from 92% identity to sit:TM1040_3700)

MetaCyc: 77% identical to alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase (Sinorhizobium meliloti 1021)
RXN-17959 [EC: 4.7.1.1]

Predicted SEED Role

"PhnJ protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• glyphosate degradation III (4/7 steps found)
• methylphosphonate degradation I (2/5 steps found)
• (aminomethyl)phosphonate degradation (4/8 steps found)
• methylphosphonate degradation II (1/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.7.1.1

Sequence Analysis Tools

See I7DLZ7 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PGA1_c04270 protein PhnJ (Phaeobacter inhibens DSM 17395)
MTDYNFAYLDEQTKRMIRRAILKGLAVPGYQVPFASREMPMPYGWGTGGVQVSAATLTPD
DTLKVIDQGADDTTNAVSIRKFFENTAGVATTEETEKASVIQTRHRIPEAELSEDQILVY
QVPIPEPLRFLEPRETETRKMHSLQEYGLMHVKLYEDISQHGAIATSYAYPVKVADRYVM
DPSPIPKFDNPKMNMAAIQLFGAGREQRIYAVPPYTEVVSLDFEDYPFEASKADHPCDLC
AAEDSYLDEVILDDAGNRMFVCSDTDYCRSRRDAGHLGRLSEEAA