Protein Info for HP15_4089 in Marinobacter adhaerens HP15

Updated annotation (from data): L-lactate dehydrogenase, LutB subunit
Rationale: Specifically important for utilization of L-lactate or D,L-lactate. This is related to the LutABC system from Bacillus subtilis (PMC3347220, PMC2668416).
Original annotation: iron-sulfur cluster binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 TIGR00273: iron-sulfur cluster-binding protein" amino acids 23 to 442 (420 residues), 481.7 bits, see alignment E=1.1e-148 PF02589: LUD_dom" amino acids 74 to 298 (225 residues), 169 bits, see alignment E=4.1e-53 PF13183: Fer4_8" amino acids 315 to 381 (67 residues), 48.8 bits, see alignment E=3.4e-16 PF13534: Fer4_17" amino acids 316 to 381 (66 residues), 22.7 bits, see alignment E=4.7e-08 PF11870: LutB_C" amino acids 389 to 474 (86 residues), 88.2 bits, see alignment E=1.6e-28

Best Hits

Swiss-Prot: 42% identical to LUTB1_BACWK: Lactate utilization protein B 1 (lutB1) from Bacillus weihenstephanensis (strain KBAB4)

KEGG orthology group: None (inferred from 86% identity to maq:Maqu_0365)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLR6 at UniProt or InterPro

Protein Sequence (483 amino acids)

>HP15_4089 L-lactate dehydrogenase, LutB subunit (Marinobacter adhaerens HP15)
MSQRIPVTELTPDFRGRAEEALADGQLRNNFRVAMDSLMTKRANAFPDADEREGLRELGN
RIKAGALSRLPDLLEQLEQKLTENGVKVHWAETVEEANSLVHGIIEARKGSQVVKGKSMV
SEEMEMNDYLAERGVECLESDMGEYIVQLDNEKPSHIIMPAIHKNARQVSKLFHDKLGEP
ETEDVNQLIQIGRRTLRRKFMEADVGVSGVNFAIAETGTLLLVENEGNGRMSTTAPPVHI
AVTGIEKVVPNLRDVVPLVSLLTRSALGQPITTYVNLISGPRKPDELDGPEEVHLVLLDN
GRTGAFADAQMRQTLNCIRCGACMNHCPVYTRVGGHTYGEVYPGPIGKIITPHMAGLDKV
PDHPSASSLCGACGEVCPVKIPIPELLQRLRQENVKNPEQPQQVKGGGAKYSRTERWIWR
GWQMLNTRPALYRSFLWAATRFRALAPKKAGPWTENHSAPVPARRSLHDLAARHLDQNGG
RPS