Protein Info for HP15_4087 in Marinobacter adhaerens HP15

Annotation: transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF00392: GntR" amino acids 2 to 59 (58 residues), 74.7 bits, see alignment E=3.7e-25 PF07729: FCD" amino acids 84 to 215 (132 residues), 80.4 bits, see alignment E=1.6e-26

Best Hits

Swiss-Prot: 50% identical to PDHR_ECOLI: Pyruvate dehydrogenase complex repressor (pdhR) from Escherichia coli (strain K12)

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 76% identity to maq:Maqu_0362)

Predicted SEED Role

"Lactate-responsive regulator LldR in Enterobacteria, GntR family" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLR4 at UniProt or InterPro

Protein Sequence (243 amino acids)

>HP15_4087 transcriptional regulator, GntR family (Marinobacter adhaerens HP15)
MEQLETMILEGTLQPGERLPPERVLSEQFGVSRPSLREAIQRLTAKGLLISRQGGGNYVT
ESLGGSFSDPLIPLLENRPDAQRDLLEFRRTLEADCAYYAALRATEVDRAHLKTAYEALQ
ACYGSDRNRDLEAEGAADARFHLAIAEASHNVILLHTIRNLFNMLKSNVVTNIGGMYRRE
AETRQGLVEQHRMLYEAISEGRAEEARELAGKHIQYVQQVLSERSESHRRLERSLRRDKL
ARS