Protein Info for Psest_4207 in Pseudomonas stutzeri RCH2

Annotation: Predicted Na+-dependent transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details PF13593: SBF_like" amino acids 9 to 317 (309 residues), 371.4 bits, see alignment E=3.9e-115 PF01758: SBF" amino acids 42 to 217 (176 residues), 53.1 bits, see alignment E=3.3e-18

Best Hits

Swiss-Prot: 72% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 98% identity to psa:PST_0120)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSA7 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psest_4207 Predicted Na+-dependent transporter (Pseudomonas stutzeri RCH2)
MARPRLLPDNFTLALLGAVAIATLLPARGQGVVVFEWITNLAIGLLFFMHGAKLSGSAIL
AGMGHWRLHLLVFSCTFVLFPLLGLALRPVLTPMVGPELYLGILYLCALPATVQSAIAFT
SLARGNIPAAVCSAAASSLIGIFLTPLLVLLLMGAQGEGGSTLDAIGKIVVQLLLPFIAG
QIARRWIGDWVARNKGWLKNVDQSSILLVVYTAFSHAVVEGIWQQVPLPQLLGLVLACCL
LLALALLITWLVARWLGFDLEDRITILFAGSKKSLATGIPMAQVLFAGGALGTLILPLML
FHQIQLMVCAVLAQRYASRPETTSVAKAS