Protein Info for HP15_4072 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase with PAS/PAC sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 181 to 201 (21 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 586 to 751 (166 residues), 193.1 bits, see alignment E=1.5e-61 PF00990: GGDEF" amino acids 591 to 748 (158 residues), 163.6 bits, see alignment E=1.6e-52

Best Hits

Predicted SEED Role

"FIG00785261: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLP9 at UniProt or InterPro

Protein Sequence (753 amino acids)

>HP15_4072 diguanylate cyclase with PAS/PAC sensor (Marinobacter adhaerens HP15)
MSLISLLRLSSVLLLVLLMPALANGASQPVTQGWEYRWGDSPFTSEGVPQWVLQDAPEKW
NSIGFPSNPPGREDRENVWFRVTLPAGEWQEPVLYIFSVDLIVQVWVDGEKIYQYGEFDA
EGRGRFEGWPWHEIFLPEGYEGKPVYFRVFSNYTDIGLWGEVSIMDHPDLVLYILKNSLE
ALAIAGFATLIALLAIIFALLQTEKKTFASISLFTLASALMLVSESQASLLIAYQPLMWD
YLAAGSYYMLPVALALLLEQWLTNHRPWVINLIWKVHLVYLVGALLGALAGVFDLSSTFP
PFDALFLVSLVIIFAVVLRRIRRMLREQQILLLAFGIFCVLLIVDMAVAHGVLPWGRVPV
SWGMLLFSLAVVVISLWHYAGTQEALKRLNVSLEEKVAERTAKAEALARREQARVRMLTF
ENEKNRILGDVLTELQDCLGLKQAFGLLVRALPDICSPLKGAFYQRGSSDRYDRVAVWGF
SRPVPLPVLLDARKGLPEPSRLPQLRQWHGAEGVDREVESATLCFWVNVESASAGNVTEG
ILLLEGDGVFDNAESEYGSARLLAALDQAIQRISITLSSIALREELQKFSYEDGLTGLKN
RRYFDQLFEHESAVAQRNDLPLSLLIIDIDHFKKFNDTHGHEAGDNALKIVAGILQKQFR
ESDLVCRYGGEEFVVVMPGATSEAAMDKASQLSSAVRDVAIIHREKDLGALTVSVGVASW
PESGEKPLQILTLADRALYRAKEAGRNRVEVFG