Protein Info for Psest_4202 in Pseudomonas stutzeri RCH2

Annotation: general secretory pathway protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF05157: MshEN" amino acids 14 to 87 (74 residues), 25.5 bits, see alignment E=1.6e-09 TIGR02533: type II secretion system protein E" amino acids 19 to 501 (483 residues), 707 bits, see alignment E=5.8e-217 PF22341: GSPE_N1E" amino acids 20 to 82 (63 residues), 63.7 bits, see alignment E=2e-21 PF00437: T2SSE" amino acids 117 to 499 (383 residues), 532.7 bits, see alignment E=5.6e-164

Best Hits

Swiss-Prot: 78% identical to GSPE_PSEAE: Type II secretion system protein E (xcpR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 97% identity to psa:PST_0125)

Predicted SEED Role

"General secretion pathway protein E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSA3 at UniProt or InterPro

Protein Sequence (504 amino acids)

>Psest_4202 general secretory pathway protein E (Pseudomonas stutzeri RCH2)
MPELDVNEVTTLLEQSAQRRLPFAFARRHGVILLERGSELRLGLREGAALTAVQEAQRVV
GMRLPMQWLPQADFEQALGAAYQHDSSAAMLMVEGLGNDLDLASLADQIQETEDLLEQED
DAPIIRLINAILGEAIAENASDIHIETFEKRLVIRFRVDGILREVVQPKRELAALLVSRI
KVMAKLDIAEKRIPQDGRISLRVGGREVDIRVSTLPSANGERVVLRLLDKQAGRLTLRHL
GMNEQDRDHLEQAVKKPHGIILVTGPTGSGKTTTLYAALTTLNDRTRNILTVEDPIEYHL
EGIGQTQVNTKVDMTFARGLRAILRQDPDVVMVGEIRDQETADMAVQASLTGHLVLSTLH
TNSAIGAVTRLVDMGVEPFLISSSLLGVLAQRLVRVLCNDCKRAYVADAAECALLGVSPD
NAPTLYHDEGCEQCRGLGYRGRTGIYELVLFDDALRTMVHTRASEQDMLRHARVLGPSIR
DDGLRKVREGVTTIEEVLRVTREE