Protein Info for Psest_4196 in Pseudomonas stutzeri RCH2

Annotation: Type II secretory pathway, component PulK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF21687: T2SSK_1st" amino acids 112 to 213 (102 residues), 111.6 bits, see alignment E=3.2e-36 PF03934: T2SSK" amino acids 218 to 276 (59 residues), 57.7 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 51% identical to GSPK_PSEAE: Type II secretion system protein K (xcpX) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02460, general secretion pathway protein K (inferred from 99% identity to psa:PST_0131)

Predicted SEED Role

"General secretion pathway protein K"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRN1 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psest_4196 Type II secretory pathway, component PulK (Pseudomonas stutzeri RCH2)
MKRQRGVALITVLLVVAIVTVVSAAMVARQQLSIRASSNQLQARQAWHYALGGEALAQAI
LARDLRTGATGEPGASGEAAAVDHLLEPWAQPLPAFEIDQGEILVRIEDLAGRFNLNDLL
RDQQPNTAAVEQFRRLLLRLQISAPYAERLVDWLDPDQQPSGEFGAEDNAYLALDPPYRN
AGRRLHDLSELRLLLDMREEDFQRLAPYVAALPPNVPLNVNTASAMVLSSLSDNLSLGAA
ESLVELRRVAPFRNSAAFLAQPAMAGTTLQGTALAVGSQFFQATSEVRLGDRRLALVSLL
QREQDGSVRVLARNLGQPARLARSSDGER