Protein Info for Psest_4192 in Pseudomonas stutzeri RCH2

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF17191: RecG_wedge" amino acids 12 to 168 (157 residues), 58.6 bits, see alignment E=1.8e-19 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 27 to 662 (636 residues), 738.6 bits, see alignment E=3.6e-226 PF13604: AAA_30" amino acids 279 to 408 (130 residues), 27.2 bits, see alignment E=9.4e-10 PF04851: ResIII" amino acids 292 to 428 (137 residues), 34 bits, see alignment E=8.3e-12 PF00270: DEAD" amino acids 292 to 433 (142 residues), 87.3 bits, see alignment E=3e-28 PF00271: Helicase_C" amino acids 476 to 584 (109 residues), 68.1 bits, see alignment E=2.4e-22 PF19833: RecG_dom3_C" amino acids 613 to 675 (63 residues), 50.8 bits, see alignment E=4.3e-17

Best Hits

Swiss-Prot: 60% identical to RECG_ECO57: ATP-dependent DNA helicase RecG (recG) from Escherichia coli O157:H7

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 98% identity to psa:PST_0135)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS94 at UniProt or InterPro

Protein Sequence (690 amino acids)

>Psest_4192 ATP-dependent DNA helicase RecG (Pseudomonas stutzeri RCH2)
MSELATVPVTALKGVGAALAEKLARVGLETLQDVLFHLPLRYQDRTRVVPIGALRPGQDA
VIEGVVSGADIVMGRRRSLLVRLQDGSGTLSLRFYHFSQAQKEAMKRGTQLRCYGEARPG
ASGLEIYHPEYRALTGEPAPVEQTLTPIYPTTEGLTQQRLRNLSEQALARLGPHSLPDWL
PAELARDYQLGPLDQALRYLHRPPADANLEELAEGRHWAQHRLAFEELLTHQLSLQRLRE
RVRAQQAPALPPAKTLPQQFLANLGFAPTGAQQRVGAEIAYDLAQDEPMLRLVQGDVGAG
KTVVAALAALQALEAGYQVALMAPTEILAEQHFLNFSKWLEPLGIEVAWLAGKLKGKARA
ASLEQIAGGCPMVVGTHALFQDEVVFKRLALVIIDEQHRFGVQQRLALRQKGIDGRLCPH
QLIMTATPIPRTLAMSAYADLDTSILDELPPGRTPVNTLVIADSRRLEVIERVRIACNEG
RQAYWVCTLIEESEELTCQAAETTFEDLSAALVGLRVGLIHGRMKPVEKAAVMEQFKRGE
LQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSAASHCVLLYHPPLS
QLGRERLAIMRETCDGFLIAEKDLELRGPGEMLGTRQTGLLQFKVADLMRDAELLPAVRD
AAQELLARWPQHVSPLLERWLRHGQEYGQV