Protein Info for Psest_4181 in Pseudomonas stutzeri RCH2

Annotation: Flagellar biosynthesis pathway, component FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 87 to 115 (29 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 188 to 214 (27 residues), see Phobius details PF01312: Bac_export_2" amino acids 8 to 347 (340 residues), 367.2 bits, see alignment E=4.5e-114

Best Hits

Swiss-Prot: 38% identical to FLHB_ECOLI: Flagellar biosynthetic protein FlhB (flhB) from Escherichia coli (strain K12)

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 71% identity to pmy:Pmen_4425)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRM1 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psest_4181 Flagellar biosynthesis pathway, component FlhB (Pseudomonas stutzeri RCH2)
MSEQNSSQEKTEEASEQKLKKSRDDGQVTRSKDVATTVSLLATLLLLKLSAGVFLDGMQQ
SFSYSYINFQQSEIGIDDVQVILLHNLLVFVSVLLPLLLTPILVIAFALVPGGWVFASKN
FAPNFGKLNPITGLGRMVGAQNWSELAKSLLKISALLGIAGWQLYYAAPRLIALQRTDIF
NAIGGAFSLTFDLAFSLLLVFVLFSFIDIPLQRFFFLKKMRMTKQERKEEHKNQEGRPEV
KARIKQLQRQLAQRQITKVIKEADVVIVNPTHYAVALKYDPKKAETPFVIARGVDEMALY
IRKMAQANALEVIELPPLARAIYYSTQVNQQIPAPLYTAVAHVLTYILQLKAWKQGRRQG
KPALASNIHIPEELFNRARS