Protein Info for Psest_4180 in Pseudomonas stutzeri RCH2

Annotation: Flagellar biosynthesis pathway, component FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 168 (30 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details PF01311: Bac_export_1" amino acids 11 to 51 (41 residues), 38 bits, see alignment 7.1e-14 amino acids 49 to 212 (164 residues), 140.6 bits, see alignment E=3.1e-45

Best Hits

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTD7 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Psest_4180 Flagellar biosynthesis pathway, component FliR (Pseudomonas stutzeri RCH2)
MHAGQYLQSLLAYWWPFCRIMAVFSLAPMFNHKAISVRVRILLALALTLVLGLALLLVFT
VFTLIGDVVSTQLGLSMAVFNDPMNGVSSASIIYQLYFILLALLFFAVDGHLVTVSIIYQ
SFVYWPIGSGLFYDGLQTIAWSMAWVISAALLIALPIVFCMTLVQFCFGLLNRISPAMNL
FSLGFPMAILAGLSLIYLTLPNFAEAYLHLTRDLLDKIGVLLRSSGHV