Protein Info for HP15_4047 in Marinobacter adhaerens HP15

Annotation: metallo-beta-lactamase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00753: Lactamase_B" amino acids 25 to 173 (149 residues), 42.1 bits, see alignment E=1.5e-14 PF12706: Lactamase_B_2" amino acids 32 to 176 (145 residues), 43.5 bits, see alignment E=4.4e-15 PF07521: RMMBL" amino acids 375 to 418 (44 residues), 35.1 bits, see alignment 1.6e-12

Best Hits

KEGG orthology group: None (inferred from 58% identity to alt:ambt_06035)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLM4 at UniProt or InterPro

Protein Sequence (460 amino acids)

>HP15_4047 metallo-beta-lactamase family protein (Marinobacter adhaerens HP15)
MIPEQSDLWFLPLGGTGEIGMNLNLYGHDGAWLMVDCGVTFPKPGRIAADGTVHHRGEPP
VQMADPAFIADRRERLAGLVITHAHEDHVGAVPYLWPLLQCPIYTSRFTAEILRRKLAEF
DLLHRVPIIEVETGQSKQVGPFSVQWLALTHSIPDPNALMIRTAAGNIFHSGDWKLDEQP
LVGHGYSPKTFTDLANEGVNAMVCDSTNATVSGHSVSEAALHEGLLRATRSAEGRVVVTC
FGSNIARLYTLASIARETGRYMGLLGRSLINMSGAARAAGLWDSADQLINPAHLGYLPRD
EVLAVATGSQGEPRTALRRLASGTHPDFELEAGDTVIFSARAIPGNEESIEALVTRLQEL
GVRVITAEDADLPIHASGHPAQEELELMYKWVKPAIAIPVHGEAEHMETHADIAKATGVP
RAMVGRNGDLFMIRPVPGIRRQVVETGRLGWHKEGLVRVE