Protein Info for HP15_4037 in Marinobacter adhaerens HP15

Annotation: hydratase/decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03218: 4-oxalocrotonate decarboxylase
  • amino acids 2 to 263 (262 residues), 501.3 bits, E=2.7e-155
• PF01557: FAA_hydrolase
  • amino acids 91 to 263 (173 residues), 32 bits, E=5.2e-12

Best Hits

Swiss-Prot: 88% identical to DMPH_PSEUF: 4-oxalocrotonate decarboxylase (dmpH) from Pseudomonas sp. (strain CF600)

KEGG orthology group: K01617, 4-oxalocrotonate decarboxylase [EC: 4.1.1.77] (inferred from 67% identity to mpt:Mpe_A2272)

MetaCyc: 86% identical to 4-oxalocrotonate decarboxylase subunit (Pseudomonas putida mt-2)
4-oxalocrotonate decarboxylase. [EC: 4.1.1.77]

Predicted SEED Role

"4-oxalocrotonate decarboxylase (EC 4.1.1.77)" in subsystem Benzoate transport and degradation cluster (EC 4.1.1.77)

MetaCyc Pathways

• meta cleavage pathway of aromatic compounds (9/10 steps found)
• catechol degradation II (meta-cleavage pathway) (6/7 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (3/4 steps found)
• 3-chlorocatechol degradation III (meta pathway) (3/4 steps found)
• catechol degradation to 2-hydroxypentadienoate II (3/4 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• orthanilate degradation (3/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (3/5 steps found)
• 2-aminophenol degradation (2/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (3/6 steps found)
• 2,3-dihydroxybenzoate degradation (2/5 steps found)
• 2-nitrobenzoate degradation I (3/7 steps found)
• L-tryptophan degradation IX (6/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (6/12 steps found)
• 4-chloronitrobenzene degradation (2/9 steps found)
• 4-nitrotoluene degradation II (2/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (2/10 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.77

Use Curated BLAST to search for 4.1.1.77

Sequence Analysis Tools

See E4PLL4 at UniProt or InterPro

Protein Sequence (264 amino acids)

>HP15_4037 hydratase/decarboxylase (Marinobacter adhaerens HP15)
MSKTLNQEQVLALAEHVENAELQAHDITKVTNDFPDMTFEDAYDVQWEIRRRKEARGNKI
VGMKMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVNTKELIHPKIEAEIAFVTKAPL
KGPGCHIGQVLAATDFVIPAVEVIDSRYENFKFDLVSVVADNASSTRFITGGQMADVADV
DLKTLGVVVEKNGEVVDVGAGAAVLGHPASSVAMLANLLAERGEHIPAGTFIMTGGITAA
IAVEPGDNITVRYQGLGTVSARFE