Protein Info for Psest_4169 in Pseudomonas stutzeri RCH2

Annotation: ATPase FliI/YscN family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR01026: ATPase, FliI/YscN family" amino acids 9 to 440 (432 residues), 536.1 bits, see alignment E=3.2e-165 PF00006: ATP-synt_ab" amino acids 149 to 360 (212 residues), 278.5 bits, see alignment E=3.8e-87 PF18269: T3SS_ATPase_C" amino acids 369 to 437 (69 residues), 73.1 bits, see alignment E=1.3e-24

Best Hits

Swiss-Prot: 56% identical to FLII_PSEAE: Flagellum-specific ATP synthase (fliI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 89% identity to pmy:Pmen_4414)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTM2 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Psest_4169 ATPase FliI/YscN family (Pseudomonas stutzeri RCH2)
MALRDSFRLDEALRSLDNVQLAKVSGRLVRVSGMLLESLGCQRMTGQRCYVEQGDGSMLE
AQVVGFNRDITYLMPFKKPVGLTAGSRVFPAPDDAKLHIDESWLGRVVNGLGEPLDELGK
LGGRDPLPTELPSVNPLKRKPVSEALDVGVRAINATLTLGKGQRVGLFAGSGVGKSVLLG
MITRQTKADVVVVGLIGERGREVQEFLLHSLGEEGLKKAVVVVAPANESPLMRLKATELC
HSIAAYFRDQGHDVLLLVDSLTRYAMAQREIALALGEPPATKGYPPSVFGMLPELVESAG
NGASDNGSLSAIYTVLAEGDDQQDPIVDCARAILDGHIVLSRRLAEAGHYPAIDVCASVS
RCMSQVGQPAHLGAARQLKECYSTFEKIKELIPLGGYTPGADIKTDRAVQLAPTIERFLR
QDVGEAAELETSVATLQNILGKPR