Protein Info for PGA1_c04200 in Phaeobacter inhibens DSM 17395

Annotation: phosphate uptake ABC transporter permease protein PhoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 24 to 283 (260 residues), 244.3 bits, see alignment E=6.8e-77 PF00528: BPD_transp_1" amino acids 110 to 275 (166 residues), 52.8 bits, see alignment E=2.2e-18

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 81% identity to sit:TM1040_3707)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXG8 at UniProt or InterPro

Protein Sequence (289 amino acids)

>PGA1_c04200 phosphate uptake ABC transporter permease protein PhoE (Phaeobacter inhibens DSM 17395)
MTHATVSARPVADIQAEYQALIQRKRLYGGVILAVFVAMMAAGFRIADDRNAGSFWNGIT
HVFDYPSEVLSEAVEKVSLLPAHVVQFFPALIETLNIAAAATLIGAIFGTLLSLLATRGL
ARWPSLIPVFRRLLDIFRAIPEIVIALVLIFLLGGGPVPAMIAIAIHTAGALGKLFSEVN
ENASLKPVEGLASVGAGWAQRMVLGVFPQVGPNYVSYALLRFEINIRASAILGFVGAGGI
GYELRNAMSWGQGRYDEAAAIFLLLFFTIVLVDQLSGLLRDRLTHGAKQ