Protein Info for Psest_4160 in Pseudomonas stutzeri RCH2

Annotation: RNA polymerase sigma factor, FliA/WhiG family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 27 to 234 (208 residues), 100.5 bits, see alignment E=7.6e-33 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 30 to 234 (205 residues), 229.2 bits, see alignment E=5.2e-72 PF04542: Sigma70_r2" amino acids 30 to 100 (71 residues), 48 bits, see alignment E=1.8e-16 PF04539: Sigma70_r3" amino acids 108 to 146 (39 residues), 26 bits, see alignment 1.6e-09 PF08281: Sigma70_r4_2" amino acids 183 to 224 (42 residues), 34.1 bits, see alignment 3.6e-12 PF04545: Sigma70_r4" amino acids 188 to 234 (47 residues), 47.7 bits, see alignment 1.8e-16

Best Hits

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 78% identity to pmy:Pmen_0191)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTB9 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Psest_4160 RNA polymerase sigma factor, FliA/WhiG family (Pseudomonas stutzeri RCH2)
MNATCSVDYYGASPASPALFAPGAEQRWLMQYLPLVKRIVRQLSLQANQVLDREDMEQIG
MIGLLEGLRRYGEPDEQFGRFAALRIRGAILDELRRQDWRPRQVRQQAHKVRDAIRELTR
QLGHSPSDEEIKTFTGLDEKDYQAFLWADSSEAIESLDELLQSGHEHFPDTAELFEERLL
KERLLEQALSRLDERERLVLTLYYQHELSLKEIALVLEVSDARVCQLSKQAIGKACRFLT
ERSQ