Protein Info for HP15_4021 in Marinobacter adhaerens HP15

Annotation: exporters of the RND superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 821 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 221 to 223 (3 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 357 to 381 (25 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details amino acids 622 to 640 (19 residues), see Phobius details amino acids 647 to 664 (18 residues), see Phobius details amino acids 675 to 694 (20 residues), see Phobius details amino acids 715 to 738 (24 residues), see Phobius details amino acids 748 to 772 (25 residues), see Phobius details PF03176: MMPL" amino acids 135 to 279 (145 residues), 30.5 bits, see alignment E=1.8e-11 amino acids 552 to 771 (220 residues), 65.3 bits, see alignment E=4.9e-22 PF02355: SecD_SecF" amino acids 610 to 764 (155 residues), 29 bits, see alignment E=6.9e-11

Best Hits

KEGG orthology group: None (inferred from 55% identity to mpt:Mpe_A2270)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKW3 at UniProt or InterPro

Protein Sequence (821 amino acids)

>HP15_4021 exporters of the RND superfamily (Marinobacter adhaerens HP15)
MPGLHRFTHLLHLLEVWIFNNPRKVLSVIAILTLIFALRIPGLKIYTDFADLLPQQHPYI
QLHNSIKDSFGGANVLVVGVEFSDGDIFTNDNLARIDRITQAVDSLPGVNHNLVSSVTHR
NSRKIWLTEVGSINSEPYYDSTSGEYSQQALDAMRADVAANPRVYGPLVSPDLKMALVKA
QLIEGKLDYEATFAQLQELRANEAGEGVTIYATGQPVLVGWAYTYMDQILQIFIFTVLTM
LALLIFHFRKAYGVLIPLGGVLISTVWGLGIISVLGYNLDPLGLVIPFLIAARAMSHGVQ
LVERYYAETLVLGSGPKAAKATFDSLFRPGSLGVVSDAIGLSLIAIGSIPLNTHLGIYAS
LWAITVVFTVLIGVPLLLSILPTPKNPEIRETALRHIGASCSRTVTRPGAARVILAVAAI
SMLGGLLAASNVQIGDSEPGSPILYPDHDYNISSRVVNDRFPGSEELYIVAETSEKGGLK
RPEVLEALSDLQAHMLLDPEVGGSKGLPDLVKQVNRLMHNDDPRWYQIPHDAGYVGGLMF
TYMASSPVPGALDEFNDTDDRVANLVFYYKDRQGETIRRAIHMAKEWIAENGDSVDGLTI
RLAGGTLGVAAAMNESAFETNVIVLPLVFLLIFAFVMLFYTSWHAGLMMLLAMLFATTLT
YAYMGLNGLSIDINTVPVIAVGIGVGIDYSIYMMDRIREEMAKCGDLRESVRRAISTTGM
AISFTALTLMAGIIMWVIFSNLRFQSDAALLLCVMIVINGMAAMLLVPSWVLAFKPRFIT
DVYADEDGILHSDHKETKSAPSPVLDSRQDDGFVTGAPYRA