Protein Info for PGA1_c04190 in Phaeobacter inhibens DSM 17395

Annotation: phosphate uptake ABC transporter periplasmic solute-binding protein PhoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03431: phosphonate ABC transporter, periplasmic phosphonate binding protein" amino acids 2 to 300 (299 residues), 313.1 bits, see alignment E=1.9e-97 TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 7 to 259 (253 residues), 223.2 bits, see alignment E=3.8e-70 PF12974: Phosphonate-bd" amino acids 30 to 290 (261 residues), 183.9 bits, see alignment E=1.8e-58

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 86% identity to sil:SPO0781)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJ28 at UniProt or InterPro

Protein Sequence (302 amino acids)

>PGA1_c04190 phosphate uptake ABC transporter periplasmic solute-binding protein PhoD (Phaeobacter inhibens DSM 17395)
MKNLFIAILATTALTAPVLADTAEIQEFRIGILGGENAQDRLNNNECLRQKTEDLLGVET
KLFAPADYNGVIQGLLGGTIDMAWLGASGYAKTYLSDPAAVEPILVKVNNDGGYGYYSVG
FARKDSGITSLDDMQGKAFGFGDPNSTSGFLIPSIEIPEATGATMTSGDYFGEVKFTGGH
EQTIVAVANGDVDAGVSWADGLGEWEDGFNSGALRRAVDAGLVDMNDLVQIWQSKPIPEG
PVVLRTELPEDVKLKMTGLMASLKSMDAECFYGVAAGEAKGFMPITHDAYEVIIEARKLK
SN