Protein Info for HP15_4018 in Marinobacter adhaerens HP15

Annotation: membrane protein containing antibiotic biosynthesis monooxygenase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details PF03992: ABM" amino acids 16 to 87 (72 residues), 40.2 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: K09932, hypothetical protein (inferred from 41% identity to dmr:Deima_2732)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKW0 at UniProt or InterPro

Protein Sequence (198 amino acids)

>HP15_4018 membrane protein containing antibiotic biosynthesis monooxygenase domain (Marinobacter adhaerens HP15)
MMDSQSTASQQGPTDPLTVVVSRRVKKGNQEEFEALSSKMTERASRFPGYLGTAMFRPAS
PDDPEYRIVFKFRDRESLAAWEASNERAELLEQIESLLVQPSEREVTSGIVTWFTLPGQN
PVTPPPKWKMTLVSWLALYPAVTLVFVMFGDWLAQIPLFVRTLLVTAVVMLLMSYVLMPR
MTRWFAFWLFPKKGDSSR