Protein Info for HP15_4016 in Marinobacter adhaerens HP15

Annotation: deoxyribodipyrimidine photolyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR02765: cryptochrome, DASH family" amino acids 3 to 422 (420 residues), 494.6 bits, see alignment E=1.3e-152 PF00875: DNA_photolyase" amino acids 3 to 161 (159 residues), 114.1 bits, see alignment E=6.8e-37 PF03441: FAD_binding_7" amino acids 277 to 420 (144 residues), 145 bits, see alignment E=2.1e-46

Best Hits

KEGG orthology group: K01669, deoxyribodipyrimidine photo-lyase [EC: 4.1.99.3] (inferred from 77% identity to maq:Maqu_0320)

Predicted SEED Role

"Cryptochrome"

Isozymes

Compare fitness of predicted isozymes for: 4.1.99.3

Use Curated BLAST to search for 4.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKV8 at UniProt or InterPro

Protein Sequence (440 amino acids)

>HP15_4016 deoxyribodipyrimidine photolyase (Marinobacter adhaerens HP15)
MRTLYWFTRDLRLHDNASLLAASKSDMLLCLYVVDPRWFAPGPLQSKAMGDHRWRFLWQS
LMALERSLRPLGQRLHIAFGEPETVIPQLAHAHSIERVVRSRLPGTQEAGQWQAIKDRLP
KAVFQQFETLSLFTEGSLPMALEELPDTFSQFRKQVEKTGDRCSERLRIRTLTALPPPPG
FPEDNRGDCPPIPEPVHPLQFMGGEAAGLARLQEFLYGNHSIDRYKETRNALDTWDASSK
FSPWLANGCLSVREVAETITEYEASETKNESTYWLWFELLWREYFYWYALKHGANLFRRD
GVQRKRRHGTFYGHRFKAWCQGNTEYPIVNAAMNQLRETGYMSNRARQLVASCFINELGL
DWRYGAAWFEEQLIDYDVGSNYGNWQYLAGVGADPRGLRQFNLEKQTQQYDPTGTFIDRW
GGHADQPVGLHTVDAADWPL