Protein Info for Psest_4145 in Pseudomonas stutzeri RCH2

Annotation: Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10135: Rod-binding
  • amino acids 45 to 95 (51 residues), 41.3 bits, 1.8e-14
• PF01464: SLT
  • amino acids 146 to 246 (101 residues), 88.7 bits, E=2.1e-29

Best Hits

KEGG orthology group: None (inferred from 66% identity to pmk:MDS_0228)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See L0GTA3 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psest_4145 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) (Pseudomonas stutzeri RCH2)
MSIVSLPQHLNAMRARHDGPSAARRQQLEMVSEQFEAMFLQQILKQMRKAGDVLSAGNPM
RSRELDTMRDFYDEVLAETLAGKRQTGIADMLVQQLSGGLDGTAPAPAALGLASAGQGGQ
HALRGTWQRGVDALDNAWAAGKAGFRALVDSVIKQESSGNVAAVSPKGARGLMQLMPGTA
RDMAAELGLPFDEARLTSDAEYNKRLGSAYLNKMLERYDGHQALALAAYNAGPGKVDEWL
KNHGDPRRGEIDAASWIHKIPYQETRDYTRNILKDLQAANSQPREPQAAVQSSGWPQAAQ
ASLATAERLSRGQLLAVVEGKRIAEQQPASAAFNSAPAAVALDRQQPVAARHLSVAFAQP
IRIDSKEALS