Protein Info for Psest_4143 in Pseudomonas stutzeri RCH2

Annotation: flagellar hook-associated protein 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR02550: flagellar hook-associated protein 3" amino acids 2 to 183 (182 residues), 161.3 bits, see alignment E=2.3e-51 PF00669: Flagellin_N" amino acids 3 to 139 (137 residues), 63.7 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K02397, flagellar hook-associated protein 3 FlgL (inferred from 72% identity to pmy:Pmen_0216)

Predicted SEED Role

"Flagellar hook-associated protein FlgL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPE0 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Psest_4143 flagellar hook-associated protein 3 (Pseudomonas stutzeri RCH2)
MRISNAQITAMMHGSLNNSSEKLGKLMQQMASGERMLVPSDDPISAVRVLRIQREEASLT
QYRTNIANVSGNLSKQEANLKAASDSMLSIRDLLLWAANGSNTDEDLSAIANELEALENT
VLSFANVRDEEGRYLFSGTRSNQPAIALIGGIYVLQGNDQHRQAAVANGVLVEENVTAAQ
VFGADVGMLNELRALVQVLKDPALDSTDPAVRAQITATMDNLDATHARLLGAVTDLGGRQ
NTLTLLSSSNEDVSLVNQKIEGELSRLDYAGASIDLNNYQLSLQATQKTYLKINGLSLFG
ML