Protein Info for Psest_4140 in Pseudomonas stutzeri RCH2

Annotation: Acyl-CoA dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 230 to 257 (28 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 11 to 116 (106 residues), 80.9 bits, see alignment E=1.9e-26 PF02770: Acyl-CoA_dh_M" amino acids 122 to 215 (94 residues), 68.7 bits, see alignment E=8e-23 PF00441: Acyl-CoA_dh_1" amino acids 244 to 364 (121 residues), 61.9 bits, see alignment E=1.7e-20 PF08028: Acyl-CoA_dh_2" amino acids 245 to 362 (118 residues), 38.8 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_0144)

Predicted SEED Role

"acyl-CoA dehydrogenase-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTA0 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Psest_4140 Acyl-CoA dehydrogenases (Pseudomonas stutzeri RCH2)
MDHLLPVQLVELQSVATDLAENVIAPLAAEVDAECRWPAHSMQAFADAGLLGLQVPSELG
GLGQGLLGLCVLTEAIARACPSSALCYGMHCVATAVIAAKATEHQRDHYLREIAQGRHIT
TLALSEHGTGAHFYLPETRLDADGEDFVVDGTKQFVTNGGHADSYVISTVAAGAEAGDFS
CLIVDKGSAGMQWLDAWAGFGMRGNSSRPLRLDQVRVPARNLLGEPGDQVWYVFEVVAPF
FLMAMAGTYLGVAQAALDEASLQLRSRRYSHSGEALRDVESLQIRYGELWTDLVKTRALV
REAARRGDAAHPEALPFILACKAEAAETAVRLANEAMTLCGGAAYRENSRAARLLRDARA
GHVMTPTTGLLKLWTGRSLLGLPLL