Protein Info for Psest_4139 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 928 TIGR00229: PAS domain S-box protein" amino acids 156 to 268 (113 residues), 30.2 bits, see alignment E=2.2e-11 PF00989: PAS" amino acids 157 to 261 (105 residues), 38.5 bits, see alignment E=3.6e-13 PF08448: PAS_4" amino acids 162 to 264 (103 residues), 39.1 bits, see alignment E=2.6e-13 amino acids 289 to 402 (114 residues), 28.1 bits, see alignment E=7.2e-10 PF13426: PAS_9" amino acids 166 to 262 (97 residues), 22.7 bits, see alignment E=3.5e-08 amino acids 303 to 401 (99 residues), 12.9 bits, see alignment E=3.9e-05 PF02518: HATPase_c" amino acids 550 to 671 (122 residues), 77.1 bits, see alignment E=4.9e-25 PF00072: Response_reg" amino acids 693 to 804 (112 residues), 37.7 bits, see alignment E=7.1e-13 amino acids 823 to 910 (88 residues), 41.1 bits, see alignment E=6.1e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to psa:PST_0145)

Predicted SEED Role

"PAS/PAC Sensor Hybrid Histidine Kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTJ1 at UniProt or InterPro

Protein Sequence (928 amino acids)

>Psest_4139 PAS domain S-box (Pseudomonas stutzeri RCH2)
MSEVLLNQIALLEAGDVQLRERIASWAAAHGLHLRTVDVGALPSEDEQPALVLLAAGLAR
PVALARQLRSRWKATQLLFLSEDASVDALHRELGPAPLLGPYWSIVTLDTKLLQQLDEAL
ASVHRRMRLRTTLARANVTVDGTHASRRPLPAAELYLHHFIDAARDAIVGLDHAGAVLYW
SAGAAELFGLPRAEVLGRPASGLPFWSAELAQALARVQDCDETLTLQHDDVGGGRTLEIV
VAAVCAASGAVVGAALTVRDVSALVAERRASELQGHQLSEERTHLQRLFDQAPGFIAITE
GPQHQLKIANRAFHQLVGARELLGRPAFKVFPQLESRALSELLQQVYVTGRPYIGRDIAV
RVRPQAGGKAERRYVNFIFQPVFREDEQVSGIFCQGHDVTAQVLAQQELQRSSERLQELV
EERTRELELSRQALYQSQKLEAIGKLTGGVAHDFNNVLQVIAGNLQLLQPLVDDNRTAAK
RVDAAGSAVERGAKLARQLLAFARRQPLRPQPTNLGRLLRDLDELLRQALGERIEIETVV
AGGLWTTMVDPNQLEQVVLNLAINARDAMPDGGKLTLELGNSMLDEHYAETQSDVTPGQY
VLLAVSDTGVGMPAEIIEQAFEPFFSTKPEGHGTGLGLSMAYGFAKQSGGHIRLYSEEGT
GTTVKLYLPRTEQPEVQAQPSTVGPVVGGSETILVVEDDLPVQATVIELLTGLGYSVLRA
NDAQSALSILQSGLPIDLLFTDVVMPGPLSSTELARQARLLLPDIAVLFTSGYTRNAVVH
GGRLDPGVELLSKPYRQEDLARKVRQLLGATHSEERAAPQQWVMVVEDQPQLLALTCEMV
EELGHRACGYANAELAAQALHEQRFDQLLLDVNLPGRSGPEFAAEALATQPWLRLVFVSG
EGRIESKLPARSLPKPFSFDQLAEILQA