Protein Info for Psest_4135 in Pseudomonas stutzeri RCH2

Annotation: Ketosteroid isomerase homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF14534: DUF4440" amino acids 12 to 124 (113 residues), 50.9 bits, see alignment E=4.8e-17 PF08332: CaMKII_AD" amino acids 12 to 130 (119 residues), 30.3 bits, see alignment E=1.1e-10 PF13474: SnoaL_3" amino acids 12 to 133 (122 residues), 61.8 bits, see alignment E=2e-20 PF12680: SnoaL_2" amino acids 19 to 123 (105 residues), 47.5 bits, see alignment E=5.9e-16

Best Hits

KEGG orthology group: None (inferred from 87% identity to psa:PST_0148)

Predicted SEED Role

"Ketosteroid isomerase homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GT96 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psest_4135 Ketosteroid isomerase homolog (Pseudomonas stutzeri RCH2)
MKTETHQDELAIRQLHETFEQATKAKDLDRIMAQYADDIVAFDAVGALQFKGVDEYRAHW
QRCFEFCQGEGFFESHELHVDVGGELACSRMLTHCGGPNAEGEMQTAWMRGTRVWARRDG
EWKVIHEHFSMPFDMQTGQVCMDQAPSQQQAG