Protein Info for Psest_4109 in Pseudomonas stutzeri RCH2

Annotation: selenocysteine-specific elongation factor SelB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 TIGR00475: selenocysteine-specific translation elongation factor" amino acids 1 to 626 (626 residues), 471.2 bits, see alignment E=5.5e-145 PF00009: GTP_EFTU" amino acids 2 to 164 (163 residues), 127.6 bits, see alignment E=1.5e-40 PF01926: MMR_HSR1" amino acids 3 to 99 (97 residues), 23 bits, see alignment E=2.5e-08 TIGR00231: small GTP-binding protein domain" amino acids 3 to 155 (153 residues), 42.6 bits, see alignment E=5.6e-15 PF03144: GTP_EFTU_D2" amino acids 191 to 259 (69 residues), 42.6 bits, see alignment E=2.3e-14 PF25461: Beta-barrel_SelB" amino acids 281 to 358 (78 residues), 90.8 bits, see alignment E=1.9e-29 PF09106: WHD_2nd_SelB" amino acids 441 to 496 (56 residues), 62.6 bits, see alignment 1.1e-20 PF21214: WHD_2nd_SelB_bact" amino acids 524 to 565 (42 residues), 47.3 bits, see alignment 4.7e-16 PF09107: WHD_3rd_SelB" amino acids 580 to 624 (45 residues), 55.9 bits, see alignment 8.3e-19

Best Hits

KEGG orthology group: K03833, selenocysteine-specific elongation factor (inferred from 94% identity to psa:PST_0161)

Predicted SEED Role

"Selenocysteine-specific translation elongation factor" in subsystem Selenocysteine metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTG5 at UniProt or InterPro

Protein Sequence (638 amino acids)

>Psest_4109 selenocysteine-specific elongation factor SelB (Pseudomonas stutzeri RCH2)
MIVGTAGHIDHGKTALLQALTGQQGDRRREERERGITIDLGYVYADLGEGSLTGFIDVPG
HERFVHNMLAGASGIDCVLLVVAADDGVMPQTREHLAIVELLGIRRALVALTKIDRVETA
RIAEVQRQIENLLVTGPLAGAPIFPVSSIRGDGVDALRTALIEEAARTAARSASGHFRLA
IDRAFSVTGAGVVVTGTAFAGRVRIGDELLLGPTGKRVRVRGLHAQNREADEAHAGQRVA
LNLAGERLAVEQIHRGDWLLHPLLHTPTQRIDIDFKLLPGEAHELKHWAPVHVHLGAQDV
TARVALLEDASLAPGEHAFAQLLLNAPSHAVHGDRIVLRDQSAQRTLGGGRVLDPYAPPR
NRRRAARLEQLRALDQPSLEQALPQLLASATNGIDPQSLARQFNRPREGWQLPHGVVEVG
TRLGPRMFDQARWSELDTTLLAALQRFHEEQPDELGPDRDRLRRYALPQLERPVFIALLE
QALAAGRIETSGPWLHRPDHRVRLSDAEEGLKERLWPLLEAGQFDPPWVRDLARDLGVDE
TQMRNLLRKLARLGLLQQVVKDLFYPEFTIRQLAGHVLQLEAQSGVIRAAAFRDRIQLGR
KRSIQLLEHFDRIGLTRRFGNERKVRPDSALAIQSALG