Protein Info for HP15_3976 in Marinobacter adhaerens HP15

Annotation: protein containing diguanylate cyclase, predicted domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF08447: PAS_3" amino acids 47 to 126 (80 residues), 47.9 bits, see alignment E=2.1e-16 PF01590: GAF" amino acids 177 to 323 (147 residues), 39.1 bits, see alignment E=1.6e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 334 to 496 (163 residues), 147.7 bits, see alignment E=1.3e-47 PF00990: GGDEF" amino acids 337 to 495 (159 residues), 129.4 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: None (inferred from 68% identity to maq:Maqu_0294)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKR8 at UniProt or InterPro

Protein Sequence (506 amino acids)

>HP15_3976 protein containing diguanylate cyclase, predicted domains (Marinobacter adhaerens HP15)
MSKASRSGNGQQTGLSARFFQKLASGVPGVLFIYWLGADRESHRCPFISERVQALFGIAP
SDLNDNADPIFAMIHPDDVESVMESIRFSADTLKTWSYRARLRLQNGDYEWFEVSSEPER
QPDGSTLWYGQFHNIQHYKNLEQSLRESEAEFSFQAGFQRLIARLSTEFINLGFGTIDQC
IDELLRSIGLFFKVDRAYLYCFTDDYAVMTNTHEWCRDGVPALIETQQEVSIEDFHWWQE
QIEGMVSGSRVVFIEDVDRLPREAAPERDLLQEQGVSSMFCVPIRVRGRVTGFFGVDSLR
RRSWRLDQADLLIIVSGLLSGALERNRLEEELLNQSIRDPLTGLHNRRYLMPRLDEMLGR
SNRRGERFALAIFDIDHFKTINDSIGHLGGDYILQRFADILVSQTRSMDVVARFGGEEFI
VVFNAVEHGDVRQFVQRILEAVHEERFVFNDKDIPVTVSAGVAGIEEFVDQPATPDALIA
GADDRLYLAKQAGRDCLVDASGTLRI