Protein Info for Psest_4108 in Pseudomonas stutzeri RCH2

Annotation: seryl-tRNA(sec) selenium transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR00474: L-seryl-tRNA(Sec) selenium transferase" amino acids 4 to 454 (451 residues), 603.3 bits, see alignment E=1.5e-185 PF12390: Se-cys_synth_N" amino acids 4 to 42 (39 residues), 50.3 bits, see alignment 2e-17 PF03841: SelA" amino acids 79 to 450 (372 residues), 563.4 bits, see alignment E=2.3e-173

Best Hits

Swiss-Prot: 97% identical to SELA_PSEU5: L-seryl-tRNA(Sec) selenium transferase (selA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 97% identity to psa:PST_0162)

MetaCyc: 56% identical to selenocysteine synthase (Escherichia coli K-12 substr. MG1655)
L-seryl-tRNA(Sec) selenium transferase. [EC: 2.9.1.1]

Predicted SEED Role

"L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)" in subsystem Selenocysteine metabolism (EC 2.9.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPA7 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Psest_4108 seryl-tRNA(sec) selenium transferase (Pseudomonas stutzeri RCH2)
MSSSHLPSVDKLLRDPACQPLQQRYGRQALLSTLRDLLDELREPARHGQLAALELSEAVL
AGRAGERLANQHRSRVRRVFNLTGTVLHTNLGRALLPDEAIEAITLAARYPLNLEFDLAT
GKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVLLALNSLGARKEGIISRGELIEIGGAF
RIPDIMARAGVKLHEVGTTNRTHAKDYEAAINPRSGLLMRVHTSNYSVQGFTASVATAEL
ARIAHAHDLPLLEDLGSGSLLDLSRWGLPKEPTVQEALRDGADIVTFSGDKLLGGPQAGL
IVGSKALIQKIKNNPLKRTLRVDKLTLAALEAVLNLYRDPDRLAERLTSLRLLSRPQAEI
RTQAERIAPALTAVLGETWQVAVTDALGMIGSGAQPVARLPSAALCIRPQQPKRLRGRSL
RQLEEALRCLPIPVLGRIDDDAFWLDLRQLDDEPTFLELLPHLQEELAR