Protein Info for HP15_3974 in Marinobacter adhaerens HP15

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00106: adh_short" amino acids 7 to 187 (181 residues), 126.7 bits, see alignment E=2.5e-40 PF08659: KR" amino acids 8 to 161 (154 residues), 50.1 bits, see alignment E=9.7e-17 PF01370: Epimerase" amino acids 9 to 88 (80 residues), 32.8 bits, see alignment E=1.4e-11 PF13460: NAD_binding_10" amino acids 12 to 106 (95 residues), 27.9 bits, see alignment E=6.1e-10 PF03807: F420_oxidored" amino acids 13 to 44 (32 residues), 21.6 bits, see alignment 8.1e-08 PF13561: adh_short_C2" amino acids 15 to 186 (172 residues), 82.6 bits, see alignment E=1e-26

Best Hits

KEGG orthology group: None (inferred from 82% identity to maq:Maqu_0292)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKR6 at UniProt or InterPro

Protein Sequence (260 amino acids)

>HP15_3974 short chain dehydrogenase (Marinobacter adhaerens HP15)
MRLHDRVFLLLGGTGGIGKALVEPLVRAGARVIIASRHPEKLEHREGVSLVHLDLAAPDL
DQQLVRLGDAYPDIDGVIHCAGQNCFASLGNMTVNELDAQIAVNLRSAMIVARHFAPRFE
KAEQGALVFVGSTFGSIGFPGYTAYCASKFGLRGFSEALRRELADTPVQVIYVAPRATAT
DMNPEAVNELNRALGNTMDAPEAVAAQILAAMENDDRRRFLGWPEKLFVVINGILPKIVD
KAMLKQLPVIRRFLNPGVLS