Protein Info for HP15_3970 in Marinobacter adhaerens HP15

Annotation: glycosyl transferase, group 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 227 to 248 (22 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 2 to 167 (166 residues), 35 bits, see alignment E=2.4e-12 PF00535: Glycos_transf_2" amino acids 3 to 163 (161 residues), 123.6 bits, see alignment E=1.2e-39 PF13506: Glyco_transf_21" amino acids 71 to 166 (96 residues), 22.4 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: None (inferred from 80% identity to maq:Maqu_0288)

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKR2 at UniProt or InterPro

Protein Sequence (324 amino acids)

>HP15_3970 glycosyl transferase, group 2 family protein (Marinobacter adhaerens HP15)
MLSIIIPVHNEADVIPTLLKRLDLVCRQLPGQVELLFVDDGSRDDSVAQLLRASDRYTGI
RVVQLSRNFGKEAAVTAGLESARGDAVVLMDADLQDPPELIPRMVQAWQHGADVVLMKRR
SRAGESWLKRTTASIFYRLINHISDASIPVDTGDFRLMSRRTVDALNRLPERNRYLKGMF
AWVGMPTVTLEFDRDPRLAGKTKWNYLKLMHLAMEGITSFSTRPLRIALILGLFAAGAGG
LFGTWEVIRALAFGISTPGYASMIAMITFLSGVQLLCVGLLGEYVGRIYMETKQRPVFIV
AEDSEDIAQPVLTQLRVAGNDQKH