Protein Info for Psest_0404 in Pseudomonas stutzeri RCH2

Annotation: phytoene desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02734: phytoene desaturase" amino acids 7 to 495 (489 residues), 741.8 bits, see alignment E=1.9e-227 PF00890: FAD_binding_2" amino acids 7 to 41 (35 residues), 23.8 bits, see alignment 8.9e-09 PF13450: NAD_binding_8" amino acids 9 to 70 (62 residues), 57.3 bits, see alignment E=5.5e-19 PF01593: Amino_oxidase" amino acids 15 to 491 (477 residues), 160.8 bits, see alignment E=2.5e-50

Best Hits

Swiss-Prot: 72% identical to CRTI_PANAN: Phytoene desaturase (lycopene-forming) (crtI) from Pantoea ananas

KEGG orthology group: K10027, phytoene dehydrogenase [EC: 1.14.99.-] (inferred from 96% identity to psa:PST_3873)

MetaCyc: 72% identical to phytoene desaturase (lycopene-forming) (Pantoea ananatis)
RXN-12414 [EC: 1.3.99.31]

Predicted SEED Role

"Phytoene dehydrogenase (EC 1.14.99.-)" in subsystem Carotenoids (EC 1.14.99.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.99.- or 1.3.99.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI03 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Psest_0404 phytoene desaturase (Pseudomonas stutzeri RCH2)
MNQAKRAVVIGAGFGGLALAIRLQRAGIQTTLLEKRDKPGGRAYVYHDQGFTFDAGPTVI
TDPPALEELFSGAGKRMADYVELLPVSPFYRLCWEDGYSFDYVNDQVELDRQIHALNPKD
VAGYQRFLAYSRAVYEEGYVKLGTVPFLSFRSMIGVAPQLAKLQAWRNVYSMVAKFVEND
RLRQALSFHSLLVGGNPFETSSIYALIHALERQGGVWFPRGGTGALVQGMVRLFEDLGGK
LELNAEVARIDLAGGHAKAVITGDGRRFDTDAVASNADVVNTYKQLLGHEQRGRDEAKRL
SGKRFSMSLFVIHFGLKRRHEHLQHHTVCFGPRYRELIDEIFKRETLADDFSLYLHAPCV
TDPSLAPEGCASHYVLAPVPHLGTADIDWAVEGPKYRDRIFEYLERHYMPGLRGDLVTHR
IFTPLDFRDELNAHLGSAFSLEPILTQSAWFRPHNRDDVIPNLYIVGAGTHPGAGVPGVV
GSAKATAALMLEDFMLKEHAG