Protein Info for HP15_3969 in Marinobacter adhaerens HP15

Annotation: glycosyl transferase, family 39

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 83 to 103 (21 residues), see Phobius details amino acids 119 to 147 (29 residues), see Phobius details amino acids 168 to 200 (33 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details PF02366: PMT" amino acids 30 to 243 (214 residues), 66.2 bits, see alignment E=3.6e-22 PF13231: PMT_2" amino acids 63 to 229 (167 residues), 57.5 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 65% identity to maq:Maqu_0287)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKR1 at UniProt or InterPro

Protein Sequence (515 amino acids)

>HP15_3969 glycosyl transferase, family 39 (Marinobacter adhaerens HP15)
MTRNINTLLWLLFAVLAARLGLAAILPLADTTEPRYAEIARIMAHTGDWITPWFDYGVPF
WGKPPLSFWAQALSFKLLGVSEFAGRLPSWLANVIIVYLVFTLRRHLHPERDSQAATSAG
LWAALIYATTALGFLTAGTVMTDSFLALGSTLVLTSLVVRLQGGPMVWGWLFFIGLAIGL
LAKGPLILVLTGLPVFLWVATTRRWLVLWQQLPWLRGSLLMMAIAAPWYVLAELKTPGFL
DYFIVGEHIKRFLVSSWQGDLYGNAHEFTRGTIWLYLVAASFPWGLIAIVAFGVSRWRRQ
PAPQQWQPVEKGVGGLVLASALSPAVFFTLSGNILWTYVLPGLPFLAVLASSLWPRELSG
RMPASSLAAVLTIPMMGIAAAGWLALHPEQLKTERDLVAQVEQLPHMSADNLFYLGKAPF
SARFYSRGDAHAIAQEDVIDRIESGNLHEPMALAVEKGNTAMIRRLEDLTRPIEENRRYR
LFLLKPSSGNTATSFQEKSKTGGIDYNASNDHPLS