Protein Info for HP15_3965 in Marinobacter adhaerens HP15

Annotation: membrane protein containing SNARE associated Golgi protein domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 67 to 102 (36 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details PF09335: SNARE_assoc" amino acids 63 to 178 (116 residues), 79.4 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: None (inferred from 69% identity to maq:Maqu_0283)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKQ7 at UniProt or InterPro

Protein Sequence (222 amino acids)

>HP15_3965 membrane protein containing SNARE associated Golgi protein domain (Marinobacter adhaerens HP15)
MINSSRWLVFAALVLIGYLTIHNGWLDFIADQNEVANYLHSHGVGGLVVITLAGALFTGL
GAPRQLLAFVLGFALGGLNGTLLSTLAAAIGATGCFLTARWLLRTPLSRRFSHRMQQFDR
LFREQTLLKVLMVRLLPVGSNLVTNLVAGCSGIRFSPFLFGSTLGYLPQMLVFALAGAGI
GNANAYQLAVSIGFFILASLIGAFLYHNQRARTLADSVSDSL