Protein Info for HP15_3964 in Marinobacter adhaerens HP15

Annotation: glycosyl transferase, family 39

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 86 to 115 (30 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 176 to 207 (32 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 436 to 455 (20 residues), see Phobius details PF02366: PMT" amino acids 24 to 239 (216 residues), 42.2 bits, see alignment E=7.7e-15 PF13231: PMT_2" amino acids 76 to 237 (162 residues), 66.7 bits, see alignment E=3.1e-22

Best Hits

KEGG orthology group: None (inferred from 75% identity to maq:Maqu_0282)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKQ6 at UniProt or InterPro

Protein Sequence (582 amino acids)

>HP15_3964 glycosyl transferase, family 39 (Marinobacter adhaerens HP15)
MPASPFVRHLPDTVFNLSRNQLLLLLLAFAAVVIFTGIGLRSPWPADEPRFAEVAREMVA
SGQWLIPMRGGEFYPDKPPVFMWSIAFFYWLTGNLKIAFLLPNALCSLLTLGLVFDLGTR
LWNQRTGAIAVMLLMLAPQFVIQAQKAQIDAMVACWIAVACYGLIRHFFTGPAWGWYFVG
WAFMGLGIITKGVGFLPALMLIPIVVMKLRDRALFRGTLTWRCALGPLAMLAVVAAWLIP
MVLYVNNLGTEEALAYRNNILFKQTGERYADSWGHIQPWYYYLTSVIPSLWFPLPLLLLA
LIRPLSETARYRPIIPVLLGWIALVIVFFSLSPGKRGVYLLPALPMLALILAPLLSSQKP
AGWFPPLLTGVQFLLGIALMAVGVLAWNDHPRLVEKVADYSTDPAKLHEAGTFVFVIGLA
WLITLFGFWRSRALGRLFLAMMITWLLLGTWGYRILEPLRTPRNVLAAVEQHIPPGGQLG
MIDFREQFLLFSKRDFTHFSFFTGREQENRNAWLWMSETEDSYLLVADQIKLPCFTKEGA
IPVGTAHRDSYLLLTDEQMNPSCTPPDKVKRFTTPEPGSWQD