Protein Info for Psest_4094 in Pseudomonas stutzeri RCH2

Annotation: Aspartokinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 3 to 297 (295 residues), 65.5 bits, E=1.3e-21
• PF13840: ACT_7
  • amino acids 399 to 461 (63 residues), 38.9 bits, E=1.3e-13
• PF22468: ACT_9
  • amino acids 404 to 463 (60 residues), 44 bits, E=3e-15
• PF01842: ACT
  • amino acids 414 to 461 (48 residues), 29 bits, 1.5e-10

Best Hits

Swiss-Prot: 98% identical to AKECT_PSEU5: Aspartate kinase Ask_Ect (ask) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 98% identity to psa:PST_0177)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4) associated with ectoine biosynthesis" in subsystem Ectoine biosynthesis and regulation (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• ectoine biosynthesis (5/5 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• norspermidine biosynthesis (4/6 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of polyamine biosynthesis III (5/8 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See L0GTE6 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Psest_4094 Aspartokinases (Pseudomonas stutzeri RCH2)
MHTVEKIGGTSMSRFEEVLDNIFIGRREGAALYQRIFVVSAYSGMTNLLLEHKKTGEPGV
YQRFADAQNEGAWREALEQVRQRMLEKNAELFSSEYELHAANQFINSRIDDASECMHSLQ
KLCAYGHFQLSEHLMKVREMLASLGEAHSAFNSVLALKQRGVNARLADLTGWQQEAPLPF
EEMIASHFAGFDLSRELVVATGYTHCAEGLMNTYDRGYSEITFAQIAAATGAHEAIIHKE
FHLSSADPNLVGADKVVTIGRTNYDVADQLSNLGMEAIHPRAAKTLRRAGVELRIKNAFE
PEHGGTLISQDYKSEKPCVEIIAGRKDVFGIEVFDQDMLGDISHDMEISKLLKQLKLYVV
NKDSDANSITYYASGSRKLINRAARLIEEHYPAAEVTVHNLAIVSAIGSDLKVKGILAKT
VAALAEAGISIQAIHQSIRQVEMQCVVNEEDYDAAIAALHRALIEPENHGDVIAAA