Protein Info for HP15_3961 in Marinobacter adhaerens HP15

Annotation: two-component transcriptional regulator, winged helix family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 112.2 bits, see alignment E=1.5e-36 PF00486: Trans_reg_C" amino acids 158 to 231 (74 residues), 82.9 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 40% identical to ARCA_HAEIN: Aerobic respiration control protein ArcA homolog (arcA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 65% identity to sno:Snov_1984)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKQ3 at UniProt or InterPro

Protein Sequence (241 amino acids)

>HP15_3961 two-component transcriptional regulator, winged helix family (Marinobacter adhaerens HP15)
MSDSPTILVVDDHRDIRDLVGRYLQEHGLRVLLADGGDAMKRQLRQHSVDLVVLDIMMPG
DDGLTLCRYLREHTELPVILLTAMSEETDRIVGLEMGADDYLTKPFNPRELLARIKAVLR
RTTALPPQRSPMAGQSLTFEGWTLDVDRHQLIDPEGVEVSLSTAEYKLLLAFLEHAGRVL
SRDQLMDLTLGREADAFDRSIDNHVSRLRRKIDPDARSPRLIKTIWGGGYQWIAAVEGAE
Q