Protein Info for Psest_4093 in Pseudomonas stutzeri RCH2

Annotation: ectoine hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR02408: ectoine hydroxylase" amino acids 22 to 297 (276 residues), 391.9 bits, see alignment E=7.6e-122 PF05721: PhyH" amino acids 45 to 260 (216 residues), 131 bits, see alignment E=3.9e-42

Best Hits

Swiss-Prot: 97% identical to ECTD_PSEU5: Ectoine dioxygenase (ectD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K10674, ectoine hydroxylase [EC: 1.14.11.-] (inferred from 97% identity to psa:PST_0178)

Predicted SEED Role

"Ectoine hydroxylase (EC 1.17.-.-)" in subsystem Ectoine biosynthesis and regulation (EC 1.17.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.- or 1.17.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP95 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_4093 ectoine hydroxylase (Pseudomonas stutzeri RCH2)
MNPMQADLYPSRQEDQPSWQERLDPVVYRSDLENAPIAAELIERFERDGYLVIPNLFSAD
EVALFRAELERMRQDPAVAGSGKTIKEPDSGAIRSVFDIHSDNELFARVAADERTAGIAR
FILGGDLYVHQSRMNFKPGFTGKEFYWHSDFETWHVEDGMPRMRCLSCSILLTDNEPHNG
PLMLMPGSHKHYVRCVGATPENHYEKSLRKQEIGIPDQNSLSELASRFGIDCATGPAGSV
VFFDCNTMHGSNGNITPSARSNLFYVYNHVDNAVLAPFCEQKPRPAFVAEREKFKPLEIQ
PQQYL