Protein Info for Psest_0403 in Pseudomonas stutzeri RCH2

Annotation: lycopene cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01789: lycopene cyclase" amino acids 6 to 375 (370 residues), 505.9 bits, see alignment E=6.8e-156 TIGR01790: lycopene cyclase family protein" amino acids 6 to 372 (367 residues), 341.2 bits, see alignment E=9.1e-106 PF05834: Lycopene_cycl" amino acids 6 to 373 (368 residues), 312.7 bits, see alignment E=1.9e-97

Best Hits

Swiss-Prot: 57% identical to CRTY_ESCVU: Lycopene beta-cyclase (crtY) from Escherichia vulneris

KEGG orthology group: K06443, lycopene beta cyclase [EC: 1.14.-.-] (inferred from 82% identity to psa:PST_3874)

MetaCyc: 57% identical to lycopene beta-cyclase (Pantoea ananatis)
RXN-12496 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]

Predicted SEED Role

"Lycopene cyclase" in subsystem Carotenoids

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.- or 5.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI95 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Psest_0403 lycopene cyclase (Pseudomonas stutzeri RCH2)
MALDADLILVGGGLANGLLALRLRQQRPDLRLLVLEQGDTLGGNHTWSFHEHDLTPAQQR
WLEPMVGKRWPGYAVIFPELQRRLASGYASIFSERFHQYLMPELSDGVRLRTTVASVEPQ
RVRLASGNILQAGAVIDGRGVRRTDQLALGFQKFLGQELRLQQPHGLREPIIMDASVAQH
DGYRFVYVLPFSADSLLIEDTYYADGDTVAPETLRANIERYAQDRGWTIAELLREEQGVL
PIVLSGDLPAFWDEACGVPQTGLAAALFHPTTGYSLPDAVRLADHLIALDRWDATSLFEA
IRDYSLAQWRQRGFFRLLNRMLFMAGPADRRWAVMQRFYRLREPLIQRFYAANLTTRDRL
RIVSGKPPVPLGEALRALAAHDLHRKDYR