Protein Info for Psest_4092 in Pseudomonas stutzeri RCH2

Annotation: Ectoine synthase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF06339: Ectoine_synth" amino acids 1 to 129 (129 residues), 201.1 bits, see alignment E=3.2e-64

Best Hits

Swiss-Prot: 69% identical to ECTC_HAHCH: L-ectoine synthase (ectC) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K06720, L-ectoine synthase [EC: 4.2.1.108] (inferred from 98% identity to psa:PST_0179)

MetaCyc: 61% identical to ectoine synthase monomer (Halomonas elongata DSM 2581)
Ectoine synthase. [EC: 4.2.1.108]

Predicted SEED Role

"L-ectoine synthase (EC 4.2.1.-)" in subsystem Ectoine biosynthesis and regulation (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRZ6 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Psest_4092 Ectoine synthase. (Pseudomonas stutzeri RCH2)
MIVRTLAECEKTDRKVHSQTGTWDSTRMLLKDDKVGFSFHITTIYAGSETHIHYQNHFES
VYCISGNGEIETIADGKIYKIEPGTLYVLDKHDEHLLRGGSEDMKLACVFNPPLNGREVH
DESGVYPLEAEIV