Protein Info for HP15_3958 in Marinobacter adhaerens HP15

Annotation: rhodanese domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 238 to 255 (18 residues), see Phobius details PF00581: Rhodanese" amino acids 7 to 126 (120 residues), 46.2 bits, see alignment E=2.8e-16 amino acids 160 to 275 (116 residues), 42.6 bits, see alignment E=3.7e-15

Best Hits

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 52% identity to sfr:Sfri_3019)

Predicted SEED Role

"Thiosulfate sulfurtransferase, rhodanese (EC 2.8.1.1)" (EC 2.8.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKQ0 at UniProt or InterPro

Protein Sequence (282 amino acids)

>HP15_3958 rhodanese domain protein (Marinobacter adhaerens HP15)
MASPLVTTDWLQENLDNERLVLIDASMATVIGKEPIVYDHPVWIPGSFQIDLEGTLCNTE
SSQLHAFPTEEQFTQEVRRLGITPERLVVLYDNQGIYSAPRAWWILRSMGLEQVFVLDGG
LPQWLAEGRETVSAPINSAASAGNMAGRLDRGRVRDSAFVLQHLDDERVSVIDARSRARF
LAQAPEPRPGVRGGHIPNSLSLPFTEVLDGYRFKPVSELEAKFRHLGTNLQPGDGHQLVF
SCGSGITACIILLAAELAGYDQLSLYDGSWADWGSDDSLPVA