Protein Info for Psest_4090 in Pseudomonas stutzeri RCH2

Annotation: diaminobutyrate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02406: diaminobutyrate acetyltransferase
  • amino acids 24 to 181 (158 residues), 192.3 bits, E=2.7e-61
• PF00583: Acetyltransf_1
  • amino acids 59 to 144 (86 residues), 50 bits, E=5.3e-17
• PF13302: Acetyltransf_3
  • amino acids 63 to 144 (82 residues), 30.5 bits, E=8e-11

Best Hits

Swiss-Prot: 51% identical to ECTA_META2: L-2,4-diaminobutyric acid acetyltransferase (ectA) from Methylomicrobium alcaliphilum (strain DSM 19304 / NCIMB 14124 / VKM B-2133 / 20Z)

KEGG orthology group: K06718, L-2,4-diaminobutyric acid acetyltransferase [EC: 2.3.1.178] (inferred from 94% identity to psa:PST_0181)

MetaCyc: 44% identical to diaminobutanoate acetyltransferase monomer (Halomonas elongata DSM 2581)
Diaminobutyrate acetyltransferase. [EC: 2.3.1.178]

Predicted SEED Role

"L-2,4-diaminobutyric acid acetyltransferase (EC 2.3.1.-)" in subsystem Ectoine biosynthesis and regulation (EC 2.3.1.-)

MetaCyc Pathways

• ectoine biosynthesis (5/5 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycine, serine and threonine metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.178

Sequence Analysis Tools

See L0GT59 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Psest_4090 diaminobutyrate acetyltransferase (Pseudomonas stutzeri RCH2)
MPTLKRNSINNPKGIVLSFPTVVLRRPTDGDGYNLHQLVARCQPLDTNSVYCNLLQCSDF
ADTAIAAENAQGELVGFISGYRPPARPDTLFVWQVAVDSSMRGQGLALRMLLALTARVAR
EHDVRFMETTISPDNAASQALFKRAFDRLHAECTTRTLFSRAAHFGGQHEDEVLYRAGPF
TVSHLEEELKEHA