Protein Info for Psest_4090 in Pseudomonas stutzeri RCH2

Annotation: diaminobutyrate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR02406: diaminobutyrate acetyltransferase" amino acids 24 to 181 (158 residues), 192.3 bits, see alignment E=2.7e-61 PF00583: Acetyltransf_1" amino acids 59 to 144 (86 residues), 50 bits, see alignment E=3.5e-17 PF13302: Acetyltransf_3" amino acids 61 to 144 (84 residues), 30.1 bits, see alignment E=7.1e-11

Best Hits

Swiss-Prot: 51% identical to ECTA_META2: L-2,4-diaminobutyric acid acetyltransferase (ectA) from Methylomicrobium alcaliphilum (strain DSM 19304 / NCIMB 14124 / VKM B-2133 / 20Z)

KEGG orthology group: K06718, L-2,4-diaminobutyric acid acetyltransferase [EC: 2.3.1.178] (inferred from 94% identity to psa:PST_0181)

MetaCyc: 44% identical to diaminobutanoate acetyltransferase monomer (Halomonas elongata DSM 2581)
Diaminobutyrate acetyltransferase. [EC: 2.3.1.178]

Predicted SEED Role

"L-2,4-diaminobutyric acid acetyltransferase (EC 2.3.1.-)" in subsystem Ectoine biosynthesis and regulation (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.178

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GT59 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Psest_4090 diaminobutyrate acetyltransferase (Pseudomonas stutzeri RCH2)
MPTLKRNSINNPKGIVLSFPTVVLRRPTDGDGYNLHQLVARCQPLDTNSVYCNLLQCSDF
ADTAIAAENAQGELVGFISGYRPPARPDTLFVWQVAVDSSMRGQGLALRMLLALTARVAR
EHDVRFMETTISPDNAASQALFKRAFDRLHAECTTRTLFSRAAHFGGQHEDEVLYRAGPF
TVSHLEEELKEHA