Protein Info for HP15_3955 in Marinobacter adhaerens HP15

Annotation: bacterial transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 62 to 82 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 212 to 214 (3 residues), see Phobius details amino acids 218 to 228 (11 residues), see Phobius details amino acids 234 to 261 (28 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details PF01032: FecCD" amino acids 19 to 322 (304 residues), 278.5 bits, see alignment E=3.1e-87

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 82% identity to maq:Maqu_0275)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKP7 at UniProt or InterPro

Protein Sequence (324 amino acids)

>HP15_3955 bacterial transport system permease protein (Marinobacter adhaerens HP15)
MPISSPSKPLLILLLAGFLAALLSVSIGSTSIGFGDTLRVITGSGTELQQTLILELRLPR
TLSAFATGGLLAVAGALMQVLLRNPLADPYVLGLSGGAAVGALLAMLAGAAGFLISGSAF
AGAMLATLLVFGLAHGSGSWTPSRLLLTGVVVAAGWGAMITLILSMTPASRLPGMLYWLM
GDLSHAATPWPGLIILVLVCLMVFPLGRALNVLARGSLQAAALGVSVRPLEWSIYLMASL
LTAAAVTMAGSVGFVGLVIPHMLRLVLGNDQRLILPACALAGGTLLVLADTLARVVIAPE
QLPVGVITALIGVPTFLYLLYRSR