Protein Info for HP15_3944 in Marinobacter adhaerens HP15

Annotation: alcohol dehydrogenase zinc-binding domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 30 to 153 (124 residues), 93.8 bits, E=1.2e-30
• PF16912: Glu_dehyd_C
  • amino acids 182 to 354 (173 residues), 39.3 bits, E=1e-13
• PF00107: ADH_zinc_N
  • amino acids 197 to 327 (131 residues), 120.3 bits, E=1.1e-38
• PF13602: ADH_zinc_N_2
  • amino acids 230 to 360 (131 residues), 48.9 bits, E=2.8e-16

Best Hits

Swiss-Prot: 38% identical to FADH_AMYME: S-(hydroxymethyl)mycothiol dehydrogenase from Amycolatopsis methanolica

KEGG orthology group: K00121, S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.1.1.284] (inferred from 61% identity to tin:Tint_1602)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• ethanolamine utilization (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• heterolactic fermentation (14/18 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• ethanol degradation I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• protein S-nitrosylation and denitrosylation (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-methionine degradation III (1/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• salidroside biosynthesis (1/4 steps found)
• serotonin degradation (3/7 steps found)
• phenylethanol biosynthesis (1/5 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• butanol and isobutanol biosynthesis (engineered) (2/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Methane metabolism
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1, 1.1.1.284

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

See E4PJZ8 at UniProt or InterPro

Protein Sequence (368 amino acids)

>HP15_3944 alcohol dehydrogenase zinc-binding domain protein (Marinobacter adhaerens HP15)
MDRQAKAVVCREWGQPVQVETITVEGPKRDEITIKIAACGVCHSDLSATTGKIPYPPPLV
LGHEAAGVVVEVGEGVTAFKEGDHVVSTFISMCGKCSQCVRGRPVLCENARKAMFNLPDG
TVRTKGADGEPLNVFGACGVMAEFATMHVDNCVKVDETVPMQNAALVGCAVMTGVGAVFN
TAKLEPGSRAAVFGIGGVGLNAIQGCVTAGAEMVVAVDSNPAKLAMAKEFGATHTVNINE
VEDAAKAVKKMTGGVDYAFECVGAGPVVEQAYKSLGRGGTAVVVGVADPKDKTSLTTLTL
PADERTLKGSWLGSARPQHDFPRILGLYKAGKLKLDELVTRTYPIEEAAQAFDDMVAGKN
ARGVIVFE