Protein Info for Psest_0401 in Pseudomonas stutzeri RCH2

Annotation: isopentenyl-diphosphate delta-isomerase, type 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR02151: isopentenyl-diphosphate delta-isomerase, type 2" amino acids 9 to 341 (333 residues), 387.9 bits, see alignment E=1.7e-120 PF01070: FMN_dh" amino acids 178 to 339 (162 residues), 57 bits, see alignment E=8.9e-20

Best Hits

Swiss-Prot: 92% identical to IDI2_PSEU5: Isopentenyl-diphosphate delta-isomerase (fni) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 92% identity to psa:PST_3876)

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 5.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGY3 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Psest_0401 isopentenyl-diphosphate delta-isomerase, type 2 (Pseudomonas stutzeri RCH2)
MSKQSLVSRKNDHLDIVLDPARAAGATGTGFGAFRFEHCALPELHLDQIDLKGALFGRSL
RAPLLISSMTGGAARSAAINAHLAEAAQHLGIAMAVGSQRVALETAGDQGLTGQLRQLAP
DILLLANFGAAQLVRGYGVDEARRAVEMIDGDALIVHLNPLQEAVQPGGDRDWRGVLQAI
EALARRLAVPVVIKEVGAGISATVARQLVDAGVAAIDVAGSGGTSWAAVEAERATDVSQR
AIAQAFADWGIPTAQALQAVREACPGTPLIASGGIRDGVEAAKAICLGADLVGQAAGVLQ
AAMLSSDAVVQHFEVLIEQLRIACFCTGSASLAELRQARLLQVSGY