Protein Info for Psest_4070 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 461 to 587 (127 residues), 27.9 bits, see alignment E=1.1e-10 PF08447: PAS_3" amino acids 490 to 568 (79 residues), 43.1 bits, see alignment E=6.2e-15 PF00512: HisKA" amino acids 600 to 667 (68 residues), 60.1 bits, see alignment E=2.6e-20 PF02518: HATPase_c" amino acids 716 to 823 (108 residues), 93.3 bits, see alignment E=2e-30

Best Hits

KEGG orthology group: None (inferred from 85% identity to psa:PST_0201)

Predicted SEED Role

"signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GT42 at UniProt or InterPro

Protein Sequence (830 amino acids)

>Psest_4070 PAS domain S-box (Pseudomonas stutzeri RCH2)
MPIPKPIGLRQWIWRAFVRSALIPLVLVETALIAIYLLTNGAIRDAQIDHLRQTALNDLQ
ASASLESRLISEQLAQVGSLTQLYRNLTAQALQGGDPVALPELALSADGVRYSPDDDGGA
AVFYSGATPAEQHDLQKIARLRQLEPLMKEIEARNPLIASLYFNSWDSFNHIYPWFFTLD
QYPADMDIPRYNFYYLADAEHNPSRGVVWTDVYLDPAGHGWMMSAIAPVYRDDFLEGVVG
IDITVSVILDQIGQLQVPWGGYAMLVSDDLTIMALPEPGEDDFGLAELTDHSYQQAIRSE
MFKPEDFQLDSRAETAELAAAISSTSNGVQQVMLGGRPQLVAWTTVAQTGWHLLAVVDET
AVFRQTNILASRYQQIGYLLIAGLVLFYIGFFAVMWLRARQLSQALLAPIAGISRMLGDI
GLGRWRPEPVRAQIRELDEMSRHTQDIGSRLSHSESERWEAQRRLELVLESATESLWEYD
IPNHTLRVRGSMLGRFGLPTGQLSDREFRQRIHPDDLPQAVAQVERIQQGLQQRYEAEYR
FADALGEYHWLLSRGRVLEQDPETGMARVLAGTHVDIDALKRVEAELRAATLQAQAASEA
KGRLLSGISHELRTPLNAILGFAQLMRMDCDDSSQSEAAEYLDEILLASRHLNQLLGEIL
EWSSLQKERPQLELQPVDVCSLMRECAELIALEVQQRGLQLDLSLPDDGLLVLAEPRRLR
QVLLNLLSNAMKYNVPNGHISLRAETSPGHVRILVEDTGLGIDQAQQAQVFEPFQRLGRE
NSMIQGTGIGLSLCLEFARLMNGQLGLHSEPGVGSRFWIELPRVAPLQPQ