Protein Info for HP15_3934 in Marinobacter adhaerens HP15

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00289: Biotin_carb_N
  • amino acids 3 to 110 (108 residues), 146.1 bits, E=1.6e-46
• PF02786: CPSase_L_D2
  • amino acids 115 to 322 (208 residues), 252.6 bits, E=8.2e-79
• PF02222: ATP-grasp
  • amino acids 142 to 293 (152 residues), 38.4 bits, E=3e-13
• PF08443: RimK
  • amino acids 144 to 310 (167 residues), 21 bits, E=6.5e-08
• PF07478: Dala_Dala_lig_C
  • amino acids 148 to 291 (144 residues), 43.8 bits, E=6.5e-15
• PF02785: Biotin_carb_C
  • amino acids 336 to 442 (107 residues), 133 bits, E=1.4e-42

Best Hits

Swiss-Prot: 54% identical to 2OCS_HYDTT: 2-oxoglutarate carboxylase small subunit (cfiB) from Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)

KEGG orthology group: K01959, pyruvate carboxylase subunit A [EC: 6.4.1.1] (inferred from 77% identity to hch:HCH_06705)

MetaCyc: 52% identical to pyruvate carboxylase subunit A (Methanococcus maripaludis)
Pyruvate carboxylase. [EC: 6.4.1.1]

Predicted SEED Role

"Pyruvate carboxylase subunit A (EC 6.4.1.1)" (EC 6.4.1.1)

MetaCyc Pathways

• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• gluconeogenesis III (7/12 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (10/18 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Citrate cycle (TCA cycle)
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.1

Use Curated BLAST to search for 6.4.1.1

Sequence Analysis Tools

See E4PJY8 at UniProt or InterPro

Protein Sequence (473 amino acids)

>HP15_3934 acetyl-CoA carboxylase biotin carboxylase subunit (Marinobacter adhaerens HP15)
MAIRKLLIANRGEIAVRIARACSELGIRSVAIHSEADEYSLHVKKADEAYQISKDPLSGY
LNPHHIVNMAVETGCDALHPGYGFLSENAELAAICEQRGITFVGPSANAISSMGDKTQAR
QTALAAGVPVTPGSEGNLADVEDAVVQAADIGYPVMLKATSGGGGRGIRRCDNEKELRQN
FERVISEATKAFGSAEVFLEKCIIEPRHIEVQILADTHGNVVHLYERDCSIQRRNQKLIE
LAPSPQLEESQREYIGDLAKRVAKQCGYVNAGTVEFLLDHDGSFYFMEMNTRVQVEHTIT
EEITGVDIIKAQIRIAAGEPLGLKQEDISYRGFAAQFRINAEDPKNGFLPSFGRISRYYS
AGGPGVRTDANMYTGYEIPPYYDSMCAKLIVWAMDWDELIARSRRALGDMGIYGVQTTIP
YYKQILEHPDFQAADFNTGFVERNPQLLEYSSKTRPESIATAIAAAIAAQAGL