Protein Info for PGA1_c04100 in Phaeobacter inhibens DSM 17395

Annotation: sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 PF00884: Sulfatase" amino acids 2 to 388 (387 residues), 150.2 bits, see alignment E=1.3e-47 PF01663: Phosphodiest" amino acids 4 to 71 (68 residues), 33 bits, see alignment E=8.1e-12 PF16347: SGSH_C" amino acids 334 to 493 (160 residues), 58 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 74% identity to sit:TM1040_2113)

Predicted SEED Role

"Sulfatase family protein (EC 3.1.3.-)" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXF9 at UniProt or InterPro

Protein Sequence (548 amino acids)

>PGA1_c04100 sulfatase (Phaeobacter inhibens DSM 17395)
MNILYIMFDQLRFDYLSCAGHPHLQTPHIDDLAQRGVRFTRAYVQSPTCGSSRMSSYTGR
YPSSHGVQFNGYPLRVGEWTMGDHLRKAGMSCHLIGKTHMVADAEGMQRLGLAPDSIIGV
RQTECGFDPFVRDDGLWAEGPDGFYDSKRSPYNEYLKSKGYPGENPWGDFANAGTEGQDV
ASGWFMVNADKPANIAEEDSETPWLTREAMRFVETAEQDGDQPWCAHLSYIKPHWPYIVP
APYHDMYAAEHVLPAVRSAAEREEAHPVFEGMMNNQIGQAFSRDEVREKVIPAYMGLIKQ
ADDQMGHLFARLEATGRMQDTMIVLTSDHGDYLGDHWLGEKNLFHEPSIKVPLIVYDPRS
EADATRGTTCDELVEAIDLLPTFLEAAGGTPVPHILEGRSLMPWLRGEMPEWRDYAVAEF
DYATLPLCEKLGLAPKDARLFMVVDRRWKFMHAEGGLRPMLFDLQDDPDELIDLAKAGAH
QEVIDLMYDRLLEWGLRMSQRITLSDTQIATRRGKSARKGILLGVYEPSEVDDTLTEAYR
RPIPKPTS