Protein Info for Psest_4056 in Pseudomonas stutzeri RCH2

Annotation: FMN reductase, SsuE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 1 to 142 (142 residues), 116.4 bits, E=4.4e-38
• TIGR03567: FMN reductase
  • amino acids 3 to 172 (170 residues), 232.9 bits, E=1.1e-73

Best Hits

Swiss-Prot: 67% identical to SSUE_PSEPK: FMN reductase (NADPH) (ssuE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 67% identity to pba:PSEBR_a5413)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• two-component alkanesulfonate monooxygenase (2/2 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)
• dibenzothiophene desulfurization (1/5 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (21/33 steps found)
• bacterial bioluminescence (3/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

See L0GRB3 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Psest_4056 FMN reductase, SsuE family (Pseudomonas stutzeri RCH2)
MMVVSLAGSPSQRSRSGVLLDAAGDWLQRHGVEVVRYAVRDFEPADLIHARFDSPVVQRF
AEHVEQADGLLVATPVYKASFAGALKTLLDLLPERALANKAVLPLASGGSAAHMLALDYA
LKPVLAALKAQEILQGVYAVDRQIAYAEGNQPARLEDELRERLEAAASQLLAALARCPRP
RSAAVERPAGQRPLEYLKTLAPAP