Protein Info for HP15_3923 in Marinobacter adhaerens HP15

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF02771: Acyl-CoA_dh_N" amino acids 6 to 128 (123 residues), 51.6 bits, see alignment E=2.4e-17 PF02770: Acyl-CoA_dh_M" amino acids 132 to 233 (102 residues), 71.9 bits, see alignment E=8.1e-24 PF00441: Acyl-CoA_dh_1" amino acids 245 to 393 (149 residues), 134.3 bits, see alignment E=8e-43 PF08028: Acyl-CoA_dh_2" amino acids 262 to 375 (114 residues), 55.2 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 70% identity to bmd:BMD_2315)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJX7 at UniProt or InterPro

Protein Sequence (400 amino acids)

>HP15_3923 acyl-CoA dehydrogenase family protein (Marinobacter adhaerens HP15)
MFELSDRAKQLQSELNEFMAAHIYPNEEAHHRQIEDAEDRWAPVPIIEELKQKAKAAGLW
NLFLPDSEFGAGLSNFEYAHLCEIMGRSAMAPEVFNCSAPDTGNMETIARYGNAEQQEQW
LKPLLDGEIRSCFSMTEPDVASSDATNIACEIRREGNEYVVNGRKWWSSGAMTRDSKIAI
VMGKTDPDAEKHKQQSMILVPLDAPGVKMIRPLHVFGYDHAPHGHAEIHYDNVRVPASNM
LLGEGRGFEIAQGRLGPGRIHHCMRTIGVAERALELMCKRANAREAFGRKLSEFDSIRKD
IARSRMEIEQARLMTLKAAHMMDTVGNKVARQEIAMIKVIAPSMALKVIDRAIQVHGGAG
VSQDTFLAEAWAKVRTLRLADGPDEVHMDSIAKMELRQYR