Protein Info for Psest_4055 in Pseudomonas stutzeri RCH2

Annotation: ABC transporter, substrate-binding protein, aliphatic sulfonates family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 30 to 312 (283 residues), 246.5 bits, see alignment E=1.7e-77 PF13379: NMT1_2" amino acids 32 to 251 (220 residues), 47.5 bits, see alignment E=4.4e-16 PF04069: OpuAC" amino acids 48 to 231 (184 residues), 38.2 bits, see alignment E=2.6e-13 PF09084: NMT1" amino acids 58 to 249 (192 residues), 49.9 bits, see alignment E=7.9e-17 PF12974: Phosphonate-bd" amino acids 70 to 187 (118 residues), 30 bits, see alignment E=7e-11

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 77% identity to pmk:MDS_4634)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GT34 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Psest_4055 ABC transporter, substrate-binding protein, aliphatic sulfonates family (Pseudomonas stutzeri RCH2)
MSTRNLRRGLVALLAATLSIGAFHVQAETLRIGYQKYGTLVLLKARGTLEQRLAGQGFAV
QWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLLYVAHEPPAPSGEAILVPED
SPIRSLTELNGKKIALNKGSNVHYLLVRALESAGLQYSDIQPVYLPPADARAAFERGSVD
AWVIWDPFQAAAEEQLQARTLRDGQGLVSNHQFYLAARPFADRNPAVISTLIGEIRDIGR
WVEANPDQATKQVAPLLGLSREITRKAVIRQGYGARPITPEVVRAQQRIADTFAELRLIP
RKLVIQDAVWAAPKSIAQYPE